PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_19419_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family ZF-HD
Protein Properties Length: 96aa    MW: 10395.6 Da    PI: 8.2207
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_19419_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.72e-312782460
                          ZF-HD_dimer  4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                                         vrY eC+kNhAaslGg+avDGC+Efm+s geegt   l CaACgCHRnFHR+eve++
  cra_locus_19419_iso_1_len_518_ver_3 27 VRYAECQKNHAASLGGYAVDGCREFMAS-GEEGTGGELICAACGCHRNFHRKEVENN 82
                                         89*************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-20177IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.4E-302779IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.2E-262879IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.8192978IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MKKRQIVVRK DIGSRRNSSA SSMGRIVRYA ECQKNHAASL GGYAVDGCRE FMASGEEGTG  60
GELICAACGC HRNFHRKEVE NNEVVSESSS PSSNDV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678524.16e-43PREDICTED: mini zinc finger protein 1
RefseqXP_010678523.16e-43PREDICTED: mini zinc finger protein 1
SwissprotQ9LJW51e-32MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A068UUU82e-43A0A068UUU8_COFCA; Uncharacterized protein
STRINGVIT_14s0108g00810.t014e-38(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486